NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209048_10000723

Scaffold Ga0209048_10000723


Overview

Basic Information
Taxon OID3300027902 Open in IMG/M
Scaffold IDGa0209048_10000723 Open in IMG/M
Source Dataset NameFreshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)34899
Total Scaffold Genes36 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions

Source Dataset Sampling Location
Location NameUniversity of Notre Dame, Indiana, USA
CoordinatesLat. (o)41.7Long. (o)-86.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000290Metagenome / Metatranscriptome1362Y
F000386Metagenome / Metatranscriptome1203Y
F000407Metagenome / Metatranscriptome1172Y

Sequences

Protein IDFamilyRBSSequence
Ga0209048_1000072314F000290N/AMSNSPNARRLGGPKLWAELSRPDAEQSQRFLAEALALLLADLLRSVLSDASPALPADEFAVERYRSLADSLADGETRRRTSIGITRAGLAKRCVTWLKLLLCPAPNAPQSAPMREFLDALGLFPALFDSEPSARSRRARLTWLLTHDRRLDASTREAATALIEACEHLGVLLWPETEIG
Ga0209048_1000072316F000407GGAGVLAFAGCQSPGYAVRPVSRIAADSVGKPVSRLEDAFGQPRKIETTPTREIYVWFFAETPAGAPVGFHGCEMEVTVDAHSAHVLGYSLSNIGWSKCGEVQRKIRVAER
Ga0209048_100007236F000386N/AMNDPAPTYLDLHVPPDEMVKYIQDLMTLPQSEIAAGSALTLAQRQWGGDTPVARAALLRWGALNLAFQDKRLEFWTVTRERDRIQVPAALVAAAGIAPLVLDNERAVFDIPALLDATLEFQPPAGRA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.