NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209713_10190491

Scaffold Ga0209713_10190491


Overview

Basic Information
Taxon OID3300027883 Open in IMG/M
Scaffold IDGa0209713_10190491 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1385
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. BACL10 MAG-120910-bin24(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean
CoordinatesLat. (o)78.8697Long. (o)8.1122Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047554Metagenome149N
F057929Metagenome / Metatranscriptome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0209713_101904912F047554AGGMILEYVLKKEHVVIEDDVHAILDLKKAGEIECWAIPEYDLVAWNKEEGCVFGLLKKSGKNYKLSFTVANHDEHELELDKALKVCNERFEAMLDW
Ga0209713_101904913F057929N/ATETFSWFVAEGELVQFDENSNRLEQSKMRHRMRHELYQSQTAKVLIERCENFPEPHLGGNYCQFGGCSGIGDNVRPTADVRLKSDIYDYVEKAFVMPCPQIEFELCFTQANQRAEMSLIFDKLPEPESGGPSSHFTLDTDAVGGTGLWYADCKLVEIKNVPSTTERVSV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.