NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209169_10069122

Scaffold Ga0209169_10069122


Overview

Basic Information
Taxon OID3300027879 Open in IMG/M
Scaffold IDGa0209169_10069122 Open in IMG/M
Source Dataset NameWarmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1826
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location
Location NameUSA: New Hampshire, Hubbard Brook experimental Forest
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008143Metagenome / Metatranscriptome338Y
F019446Metagenome / Metatranscriptome229Y

Sequences

Protein IDFamilyRBSSequence
Ga0209169_100691222F019446GAGGVTTATYAENQFLENMPGEIKEVLRWHADAQSRGQASQRIADFAGRFLGGMYEDGAVLPTNLSASAPEVLALVLLQHRTNPRSTGAWLNLGFALRRVALYRTQDPEETNRARLQSAVQAFDRALELDADNNGKNIRAWTGMSLAYHMLDMYEKELECCARALESDRSDPKLWLLYSFALKSAGREDEALSTMNDAYEAYIRAGKPDELREVFADVQSTTQRPCRQRMAQ
Ga0209169_100691223F008143GAGGMKSVGGIHRTRLAASKVHRHLVKEARRTVQKLGWQVPEDDMSPTLVGAMPLPFPVPASFETAFGYKGNLRFVQFGYTAGSPQFGYSDGGDDLPSDGSLWSWFLHHPAVAPYLPESRYPTLYGKFPSGTERPPLEQIMRRGAELPTCHCLLLDRRDRRAYVSERDQAMILFALMEPDDGDAHNVFVDGMLMSPGSEDYKVGPPPGVLDEFRRFMDSRVQAFEGA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.