| Basic Information | |
|---|---|
| Taxon OID | 3300027879 Open in IMG/M |
| Scaffold ID | Ga0209169_10000126 Open in IMG/M |
| Source Dataset Name | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 43749 |
| Total Scaffold Genes | 45 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 34 (75.56%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New Hampshire, Hubbard Brook experimental Forest | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002781 | Metagenome / Metatranscriptome | 530 | Y |
| F005157 | Metagenome / Metatranscriptome | 410 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209169_1000012610 | F005157 | GGA | MRLKSARDDFEANTLGAVPGLLGRLSYVASLHSENGTYDHWGLAKIYGSDAAQGAIRASHRVLLSEVLKKPLGVLLTDVLDSCSNEHPTEKEFLATLAQSSPKPVSPAARAHLGSVLSALSALVESRNSANLRGASQPPQPAQESQPLAGI |
| Ga0209169_1000012611 | F002781 | GGA | VNWHRLLTLFLWISPHACLGVVAVVIYKRRLYREFPCFFTYVLYEIAEFVVLFLLRVVPSVTGNQYAYAYSATLLVSIALRFGVIDEVSKDLFRDSMFLKAAARRALQCVTGLLLVMGVLLAAYAPGDNSVRLIAGIFVVNRGAAMVQCGLLLSLLLFSRFLGLSWRRPAFGIALGLGVQTSVDLAMFALRAQFTSAASINFLNLLITGTYLICVLTWLGYLLVPEHEPASPGIISHDEVETWNKELQHFLKQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |