Basic Information | |
---|---|
Taxon OID | 3300027870 Open in IMG/M |
Scaffold ID | Ga0209023_10001382 Open in IMG/M |
Source Dataset Name | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 32690 |
Total Scaffold Genes | 46 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 34 (73.91%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Erie, Canada | |||||||
Coordinates | Lat. (o) | 42.285437 | Long. (o) | -81.355591 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049491 | Metagenome / Metatranscriptome | 146 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209023_1000138237 | F049491 | N/A | MCSSVLKMRLEFASTLILFPLLAQAAPSIPNDCWSGVMAAEKAPHGQLVATGPVAQWRVGMSLVVYPTKENYEQILALGEKGQTGTFDTSRPITVIPTWILGPEPGDQDSGEEKSIAIRMQYRTAQGETGDIVLNYWTPMSGQESSLPPHQRATMAQFDQQLHDMNCRGIP |
⦗Top⦘ |