NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209985_10007575

Scaffold Ga0209985_10007575


Overview

Basic Information
Taxon OID3300027806 Open in IMG/M
Scaffold IDGa0209985_10007575 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7945
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010688Metagenome / Metatranscriptome300Y
F016803Metagenome / Metatranscriptome244Y
F061810Metagenome / Metatranscriptome131N
F063486Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0209985_1000757512F061810AGGALASSGGGNVIPIDPPILRRDLLQEDDFFVLLEDASKIVLSLGTYDRIATEQGTDLLLTEDSSKFILTVY
Ga0209985_1000757514F063486N/AMITLSWIIERLLVKPTEGSLTDVVITADWRCNGTETTGT
Ga0209985_100075756F016803AGAAGGMITFFGRLRAAWTFARHQRWVDPLPWRKDDAIALNNFFKSDTGKRFKEALLNTVLMQNASAITDRNHLQYSAGFAMGQASLVKVIEVMADQESITGQDDDPDSATNQ
Ga0209985_100075759F010688N/AMKPKTATIMVIAVGPKGHHRAIGGAPSHSACGCEDADNNAPMISIPIEALSTDMEDGEQAMPEVGDEVVLDDVRGVLKKLDNGEAYIEIRSVNGMPAEYESKEDKKEMAGPMDKEGMQKMAEEYDSEMEG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.