NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209107_10071966

Scaffold Ga0209107_10071966


Overview

Basic Information
Taxon OID3300027797 Open in IMG/M
Scaffold IDGa0209107_10071966 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1905
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004451Metagenome / Metatranscriptome437N
F008079Metagenome / Metatranscriptome339Y
F012974Metagenome / Metatranscriptome275N

Sequences

Protein IDFamilyRBSSequence
Ga0209107_100719661F012974N/AMFTEAEQVIIEYVFSLPEKEQSYKIHLLKLKAIKDRLVSYEKECFCGGVRRKIWLKDFKQWYETYT
Ga0209107_100719662F004451AGGAMRPILDQYIAAHYKEIRKYTNYFLVRMKSTISADAVINNSFLYLCNIDIEVTDPGKVKAYLLNTIKMQILWSTSLTNRQERVTATDSTMPIVMDDDTDLYDKIRDDMQYQNNMAVIETYRGRITDRIKLIVFQCYFDKGYSTARAMAEYFRIPVTSAHYWIQEIKTDLKQLRDEN
Ga0209107_100719663F008079N/AMKIKDEYIGAKISHKGNRITLDASRYDYFVSIGLGYMFEEPTVSEPKVVKYKAVKGPIPEPEVTEEDGTEAE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.