NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209972_10007985

Scaffold Ga0209972_10007985


Overview

Basic Information
Taxon OID3300027793 Open in IMG/M
Scaffold IDGa0209972_10007985 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7392
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001827Metagenome / Metatranscriptome629Y
F009260Metagenome / Metatranscriptome320Y
F053989Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0209972_1000798513F053989AGGAGMDTKKELKAHMAKGMKSAHPDAAAKKMRAGGKTNSDMLKYGRNMAKVMNQRSAGRGK
Ga0209972_1000798514F009260GGAMAEYKQPKKVPSVVVGEEPAKETMRKQVVSVANTRSQDYPPTKTTGIKMRGTGAATKGLMSRGPMA
Ga0209972_100079855F001827GAGGMNNDVKTMTDGAAVVVGLGGFMGWLTPVVTLIGGVLTIVWLALRIYETDTVQKLVGRKKDDDASNK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.