NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209246_10090102

Scaffold Ga0209246_10090102


Overview

Basic Information
Taxon OID3300027785 Open in IMG/M
Scaffold IDGa0209246_10090102 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1198
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045607Metagenome152N
F051878Metagenome143N

Sequences

Protein IDFamilyRBSSequence
Ga0209246_100901021F051878AGGAGMADTLAELIAERERRSGRVTGGVRSVLEEPKETTTLEEVKRAVTSLLKGSTKGVIDIVGGWGNLYDYIKDSKQPNPLSSIGLVNAINNLGGPDLMKIEGYKGLYQMGQAGGPAAVMSAVAPGSSLFRLGTPARTAGAEFTTAGTLGLLSQQVAPESPMAQLTMQTLPYLVVGGV
Ga0209246_100901022F045607N/ATGKQVRVSFTGGVDRKTSETKVGGVTLPAGESEFVKELGKLDAKKVSEAMVTRETATSTIKSLNKLASLPDNELITGQFATGRVGIANLIQTLGLASASDARKVAGSQEYQKVAGDVILQTLGGKLGSGFSNADREFIQGLIPQLETNPAARRQLITFMQNKNQEIVAETIRLENYARDKKGLSGFTPKIPLSVTPATKYSGLSEAELDARIAEEMKKVKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.