NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209500_10034027

Scaffold Ga0209500_10034027


Overview

Basic Information
Taxon OID3300027782 Open in IMG/M
Scaffold IDGa0209500_10034027 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2846
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049582Metagenome / Metatranscriptome146Y
F053831Metagenome / Metatranscriptome140N
F074804Metagenome / Metatranscriptome119Y
F088345Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0209500_100340271F053831GGTGGMSNWQKLNYLGDKCKPFHIRVDYCDEVVDFRDMYRFDDAVGAEWIDQTEKEIEDGYKYWVILRARVFLAGIEIGSHSLGGLLFDNTDQMESMMQSDFEDI
Ga0209500_100340272F088345GAGMDELERFFLPPDIQSWIMRYDAGNEQALVKQVPLTEDNISMIDRLADLLPLTRRYRGPRHNSRNFTRDCPKKDAERVSVYLKERVA
Ga0209500_100340276F074804AGGAGLGETRIFTTKGGIMIDERLSDQRDEFFLDIAKGDLVFLQADDGSEISGIAVERSIMGWMLEGGVEVTEYDNYLGHISLGHLLGEAA
Ga0209500_100340278F049582GGAGGMFADKTKIYQELKTRFRNESDLTLSMMTRAISDLDISNPAALDLMYEDVMFFTGDWHETQGWGSSDTAALIRSVKATLINNGYLKAAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.