NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209709_10000063

Scaffold Ga0209709_10000063


Overview

Basic Information
Taxon OID3300027779 Open in IMG/M
Scaffold IDGa0209709_10000063 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)93726
Total Scaffold Genes87 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)74 (85.06%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)75.235Long. (o)-150.0691Alt. (m)Depth (m)79
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061294Metagenome / Metatranscriptome132Y
F098084Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0209709_1000006341F098084GAGMLYTQLTTIRIGLLLLLLLVVSVTSYAGMPKQCDKPMHSDHIIYDCYGDWAVRHVFERGVLKHKYSDATTIMDVGWFGSTEFQINRRQDGSIYYIIPSQIDRVEIIIAGQTFVSKQGPSAVFYGEVTEPMLVAISQAQSPVNLLIYSEGQTIEASFSETGSSAALRWIGAID
Ga0209709_1000006345F061294GAGGVQAIDAFESRCVDYQNHCITSESTALVVYLLSHNVVYEEVNYMMPEHPPTVELLSIIVKDVCRGKSPYTPVFEQIVARYLDLVGDEGVSPQVIFYYVSNVIISLLVLSRQNSQLSAEILAKLIRRFNFRDAVLRAGVEVIAEEVLRRCFLAINDTKICRARCS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.