NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209810_1003295

Scaffold Ga0209810_1003295


Overview

Basic Information
Taxon OID3300027773 Open in IMG/M
Scaffold IDGa0209810_1003295 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17230
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (45.83%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001513Metagenome / Metatranscriptome680Y
F005548Metagenome / Metatranscriptome397Y
F007088Metagenome / Metatranscriptome358Y

Sequences

Protein IDFamilyRBSSequence
Ga0209810_100329511F001513AGGVSRLPEKLDLALVTRLRQVVAGEAATEAELRALDDEAGGWLKATEAQLRAAEERLTLLNADPVTPLAEIAAEVRRVEALTRERDEARRLIEGLERRTRELRTAWLKHHADAGSPFDPRT
Ga0209810_10032956F007088GGAGMQLFLHDPSYTDRLAAFLTSVGRRAVVGAPDRVDIDETPDDSQHLELELYLRVWRVLYPDADVELALG
Ga0209810_10032957F005548N/AVLRWLLSLFRRGRRDEASPIREADAYARSYGERSGEIVSVARAEPKPIPRRTGDMTGELLRRAFEAKLDARGRAAT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.