NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209770_10000813

Scaffold Ga0209770_10000813


Overview

Basic Information
Taxon OID3300027769 Open in IMG/M
Scaffold IDGa0209770_10000813 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16595
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (84.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001396Metagenome / Metatranscriptome705Y
F032258Metagenome / Metatranscriptome180Y
F041738Metagenome / Metatranscriptome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0209770_1000081313F001396GGAVENVWVPLAVAIITGPVVVVLQKLRKENTEQHAEGRILLKMIGTKVDRVAEKLDNHIGWHDGQKDK
Ga0209770_1000081316F041738AGGAGMQKVKDFIYNNPVRVAAFVSAFVALFAPLFSSAIPVETVAAFILSSIGLGEYAQRAENKKTDEALFSEVPEEE
Ga0209770_100008137F032258N/AMIKNSKPAHALYGEPVTGYRLAPTTGAKIAAPSAPYIGRNRCIANEDTCEGPKAKGTDFCVGHLRSQGAAK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.