NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209770_10000211

Scaffold Ga0209770_10000211


Overview

Basic Information
Taxon OID3300027769 Open in IMG/M
Scaffold IDGa0209770_10000211 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)34885
Total Scaffold Genes54 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)41 (75.93%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038479Metagenome / Metatranscriptome166Y
F043932Metagenome / Metatranscriptome155Y
F068831Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Ga0209770_1000021122F068831GGAGGLATSYPTSKDNLTNPAANESMEGHASLHGNVNDAIEAIENKLGVDGSTDVNSIDYKVSQLQANLSTLDAENASELLGLDGNNDLTIDGIENKTIVDSFSKTVYKTVRYTLQIDKSAGNLTHTSTIVLLNDGTNVYISESDIVSNTDLSLATVTFEENNGIISLCVTPVSGSIKVRYFRTALKA
Ga0209770_1000021123F043932AGGMAKKFKSLLNLLTLSEDPVIGSTGDVYFNVVSKNIKIYNGAIWVDLTPGSTDPAPFYMHTHSYDGNVHTVNLQETIDFSEINNNADVLETSPAIIGLDGGTPTSSYANASYTELTLLDGGQIGN
Ga0209770_1000021141F038479AGGAMTSLTLEQKIAKAAHLIAEGKVVSFRGASFDTYMKVERMANRIKQEQEFPQCPCGECE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.