NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209088_10000229

Scaffold Ga0209088_10000229


Overview

Basic Information
Taxon OID3300027763 Open in IMG/M
Scaffold IDGa0209088_10000229 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)41189
Total Scaffold Genes72 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)56 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001774Metagenome / Metatranscriptome636Y
F004362Metagenome / Metatranscriptome442Y
F057002Metagenome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0209088_1000022922F004362N/AMEQRLKNWAWYVTWGVIGPQVETTCRSFEKNYVPELGNLYADPEPHYEPDHVDGDLIEQAIKGLPLQLRQMLKMRYVSHPYASLNQLAHNARTTPHKLETDLYNAKKRLQQELDKKSKSNYHQNLYKLQDQKNN
Ga0209088_1000022941F001774AGGAGMALQLSLTQTQFGVPAPQAYARITNFFGTKDQIQVQVAIYYNEEARHGNMATVKENAHYIAIEDLDGDLIPAIYAVLKTFTDYAGAVDA
Ga0209088_1000022955F057002N/AMRSALTFTKESQRPTDYAGKRFDQALHDKYDPPARKAVSEWIQMKWGLECRENPNVYGVDLIAYRAGNPVGFVEVEVRGWAYCHHTTIHIAHRKAKLFLQDRPVLFFALTHDLSHAYWLKAELVKKCPLIEVNNREVPSGEFFFDVPVSWFKYVNLTDPF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.