NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209296_1065604

Scaffold Ga0209296_1065604


Overview

Basic Information
Taxon OID3300027759 Open in IMG/M
Scaffold IDGa0209296_1065604 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1838
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037565Metagenome / Metatranscriptome167Y
F073148Metagenome / Metatranscriptome120N
F078205Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0209296_10656043F037565AGGAMTMITDTKIITIDEIYEQILESYFRGELTEGEWMMNPAKVVQIFETECLKHGHRVADYTLYNSGLADECECHLDKLKTKFI
Ga0209296_10656044F078205N/AMDIISIISGILSWLQVSTGQASITAGTIYQGAAMIDKVTTEDFRGTWTAELQESGKQIIQGFVVSVNEKE
Ga0209296_10656046F073148N/AMSILLILSTSARAEITARDVWVSLVIASKVITKTQSGTWGASIHEEAQQGIKD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.