Basic Information | |
---|---|
Taxon OID | 3300027752 Open in IMG/M |
Scaffold ID | Ga0209192_10010467 Open in IMG/M |
Source Dataset Name | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5095 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic Ocean: Canada Basin | |||||||
Coordinates | Lat. (o) | 73.2247 | Long. (o) | -150.2247 | Alt. (m) | Depth (m) | 7 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F070572 | Metagenome / Metatranscriptome | 123 | N |
F101907 | Metagenome / Metatranscriptome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209192_100104672 | F070572 | AGGA | MAITKNNFALNQNYELIGHEVTILAVDFILTMAAEVNDCSDGTALGGLDLVRKTFEQQGLSILAEGPLTNSGTEKNYLVRKDSLDTLSSTTSIAALQAALQALDAASDDFPNITATITSATVAEKELIVAV |
Ga0209192_100104673 | F101907 | AGGAGG | MAYDSTIPAGGHANFVSPNTAQEHGSDGAVDFITVDLLTAGTAEVTHPLAAANTAGLHLIREAIQNQGVNILGNGVETAAFEHTFMVRRDSLDTISSTTTAAAIQAAIQALNANTKITQTISSATAADRDMGRLSAMA |
⦗Top⦘ |