| Basic Information | |
|---|---|
| Taxon OID | 3300027734 Open in IMG/M |
| Scaffold ID | Ga0209087_1005017 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7140 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (83.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Simoncouche, Canada | |||||||
| Coordinates | Lat. (o) | 48.2311 | Long. (o) | -71.2508 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000369 | Metagenome / Metatranscriptome | 1222 | Y |
| F008245 | Metagenome / Metatranscriptome | 336 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209087_10050174 | F008245 | AGGA | LGIRLDYSLINGTKGLKMAEDKNTLQLISDITEFNDLHEYMQDEHLDKALAIVVKLLMTPDVPSAKAPMLIMELQAMSTKFAVMSSVYSTIAKDKAGTVNNNKKNVYYSVKESIDKLVDALKYVVRYNS |
| Ga0209087_10050179 | F000369 | N/A | MSELEPAVHFDRMNKVVEELLKGNSATQIATLTGYSRKEVLEYLDEWKSVVHNDSNIRDRAREAISGADQHYAMLIKEAWKTVEDADTQGQLNIKAASLKLIADIETKRIAMLQSVGVLENSQIASQIAETERKQELLVGILKEVTSGCPKCKMDVAKRLSQITGIVEAVNINDAEVITNVQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |