Basic Information | |
---|---|
Taxon OID | 3300027730 Open in IMG/M |
Scaffold ID | Ga0247833_1082972 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Restricted |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1498 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Spain: Castile-La Mancha | |||||||
Coordinates | Lat. (o) | 39.9879 | Long. (o) | -1.8737 | Alt. (m) | Depth (m) | 8 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022872 | Metagenome | 212 | Y |
F083794 | Metagenome | 112 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247833_10829721 | F022872 | N/A | AQYRTFQTGVGGQSILPVPNNAYAVVFGYDYSPAGGGITANNLQLTDAQLNTAILRWFETQQISFYTGTDFYPFIHHINVEASAFTAVAGTNVVQTVDNTPIARQVYITSDKDITISVGLILDSDVATTGAIPITNRTPALLTYGGSPQTPAVQTDFGPAATPIQFMQPSPKDFQDFGFGLLPNGANGQAFATPDVTRGLLDPSVYLTLIGPTFRDAAAANYFLCLHYALYTRTIPEERG |
Ga0247833_10829722 | F083794 | AGAAG | MTATQATKQLLDMGCVFLSIVDIEGNTIVPKQQNKFTTPADIKKQAEKINTYLKTAPNGTYVIEGRIGGTSKPTQIVIDKGEPAPAIAVNNSAPSRGISDPGAESVLSYRAALDMQNQIATLTAENNRLRDLVEALEGDLADIEEAQPEQMAESPAMGALGQLAAILPAVVDKWFENQKENREIEKAKLYQAAQARQAQAQYQSNGSSDYDSL |
⦗Top⦘ |