| Basic Information | |
|---|---|
| Taxon OID | 3300027720 Open in IMG/M |
| Scaffold ID | Ga0209617_10005898 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5652 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Erie, Canada | |||||||
| Coordinates | Lat. (o) | 41.77 | Long. (o) | -81.73 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027175 | Metagenome / Metatranscriptome | 195 | N |
| F046897 | Metagenome | 150 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209617_100058983 | F046897 | GAG | MRIDEVENSSSLDPNKLMGLVNFLSGRADNENAQKQISTDAFISAAQSLGFPVNQRNVISVVSTPPLDSVLEPIDPNNPGVIMYKGANTGATQMPVNKAQDIVAASAKSAAGKDRGV |
| Ga0209617_100058985 | F027175 | N/A | MTRDQKLERFAERELKRVYTELIIDDEHGGYVAFGRYHVKPNPAGFAVYYHSDDLVSTFSSKRTAMSWCVADHLQQHRLAQNIRILDNKKQTLTADIYCRNGQADGSNRPEFREMVRTKLAPKIENLTLLNQELEKCLNSAKYLQLRGFAK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |