NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209443_1069947

Scaffold Ga0209443_1069947


Overview

Basic Information
Taxon OID3300027707 Open in IMG/M
Scaffold IDGa0209443_1069947 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1382
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004451Metagenome / Metatranscriptome437N
F008079Metagenome / Metatranscriptome339Y
F012974Metagenome / Metatranscriptome275N

Sequences

Protein IDFamilyRBSSequence
Ga0209443_10699471F008079N/AMKIKDEFIGVKVSHKGNNVNVSTENYTFCESIGLGYMFEEPTVSEPKVIKYKAVKPPIPAPVVDEPTVESDEDGTEAE
Ga0209443_10699472F004451AGGAMRPILDNYISAHYKEIRKYTNYFLVRMKSTISADAVINNSFLYLCNIDIEVTDPGKVKAYLLNTIKMQILWSTSLTNRQERVTATDSTMPIVMDDDTDLWDKIREDMQYQNNMAVIETYRGRITDRIKLIVFQCYFDKGYSTARAMAEYFKIPVTSAHYWIQEIKNDLKNLRDEN
Ga0209443_10699473F012974N/AMFTEAEQAIIQQVFSLAEKEQSYKINLIKLKAIKDRLLGYEKECFCSSVRRKIWYKDFKQWYETYT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.