NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209036_1021474

Scaffold Ga0209036_1021474


Overview

Basic Information
Taxon OID3300027702 Open in IMG/M
Scaffold IDGa0209036_1021474 Open in IMG/M
Source Dataset NameMarine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2277
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-37.9951Long. (o)-44.9972Alt. (m)Depth (m)80
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001611Metagenome / Metatranscriptome663N
F002374Metagenome / Metatranscriptome566Y
F036730Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0209036_10214742F002374AGGAMDQVLLYLSLSIAIITFFLCCYACVRVGKFLNSVKGLDWDIIATLTGDIGTVKKSIQTLNNRINGLNSPKIDQELQNYMIQMKNGALKPQDKELGG
Ga0209036_10214744F001611AGGAGMPLVQKRITLASGATSDNILANTNYEFIDGDVRVRTAVACDTAGTSTADNLFNVSVNNSEYAKDVSIPVEVTGQPFSVLSGMYQTNDLITTGAQRNRVLVQITNNTAGSRTYIVGIFIGG
Ga0209036_10214745F036730GGAGGLGQEYFINSQQLESKIRNLLPSQGGAGAGFDLSASTQIIPIVDLTESAEGSNLREDLQRAISF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.