NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208975_1001406

Scaffold Ga0208975_1001406


Overview

Basic Information
Taxon OID3300027659 Open in IMG/M
Scaffold IDGa0208975_1001406 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10190
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (16.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.701094Long. (o)-82.854085Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011226Metagenome / Metatranscriptome293Y
F011227Metagenome / Metatranscriptome293Y
F041184Metagenome / Metatranscriptome160N
F047481Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0208975_100140614F041184N/AMASDFRPGKLDIQIWRNDTWQQVFTLLADTTPISLVGATVYIQVRKGCGGTLALTLTNGSGVTIGGASNNQITVSKLVNIDKGNYVYDLQVTFSDTTVKTYLEGDFIVYDDVTKP
Ga0208975_10014067F047481GAGMDSKSIGMCVATILIKLWADLALSQVGVVVAILAGISTIVYNVYRMYKELKR
Ga0208975_10014068F011227N/AMTLVELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG
Ga0208975_10014069F011226N/AMAKQIQPVTIWVNGESKSAEYFQVTCINDNYENSATNYWALFTKVVDAEGVESMGEQVAQSNLTIDGQDYINWGDQPAMAINAWIYQWSADKLNLVILP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.