Basic Information | |
---|---|
Taxon OID | 3300027651 Open in IMG/M |
Scaffold ID | Ga0209217_1161173 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 618 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Algoma, Ontario, Canada | |||||||
Coordinates | Lat. (o) | 46.42 | Long. (o) | -83.37 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044089 | Metagenome / Metatranscriptome | 155 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209217_11611732 | F044089 | GAGG | MNYIKQLQADKTEAIDSARTIETEINDLISYLCCEKFRVDTRVQVGDVLRVLLPIRNNVTYLATNLSRPTSSSKNT |
⦗Top⦘ |