NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209217_1057238

Scaffold Ga0209217_1057238


Overview

Basic Information
Taxon OID3300027651 Open in IMG/M
Scaffold IDGa0209217_1057238 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1165
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006238Metagenome / Metatranscriptome378Y
F006319Metagenome / Metatranscriptome376Y
F006519Metagenome / Metatranscriptome371Y

Sequences

Protein IDFamilyRBSSequence
Ga0209217_10572381F006319N/AEATEHQRKRAGEEARMRFARIKSAVIGPIFDEVVARLVAKGFFGETVNEQNDASGPISLDVNLSEDDGPSRQGRLQVRFDLDKHTCEFGKSTSAKTASTTQIIFDDRHYKFDEITEELVRETAEQFVLDLIAEKLFR
Ga0209217_10572382F006238AGGMIENCPEGDIQLDALRLSSAPKLRSGECYCSRATLDELLSDAVMAPVLRSAGYEPDEFREMITETAWNLVTPSEGGKAGILY
Ga0209217_10572383F006519AGGMYISLADSRAKGFKKWADIHQPEKLGGARAGADEGSAIAASDLVQEVTAPAEQPHRPWLVPGAGTL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.