NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208974_1003511

Scaffold Ga0208974_1003511


Overview

Basic Information
Taxon OID3300027608 Open in IMG/M
Scaffold IDGa0208974_1003511 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5644
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.504638Long. (o)-83.045851Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032635Metagenome / Metatranscriptome179Y
F088543Metagenome / Metatranscriptome109Y
F090092Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0208974_100351110F088543N/AMNEIQKSKLIAAIKQVFPAVVQEMNNVRLPALESAWGRTFKEEMINEDQITVEIAKNYARPLNNAFYRNLKELIPEFNEHTTNGSDYSYDGILIEDKNSFSDANGWVGNGFKKTPIHILKKFQVDENGKIIKAFVALVDLSKCKSAWSAKAINTNRSVIQFTNDDVANIDVVIGSIKSNRKFIKPVMEILNNEQN
Ga0208974_100351111F090092GGAGMKKVEVLFTLMQSGKPVSVESMIKTLDVKQGSIMCLISALRNDFGAEVETVRDGRKVLSYQLLNADKVKIPTKAAKTPKAPKVARVAVTKTKTTVSRKAAAATDEIPTLDVQEIDSDAELASLKAELGFVDSYSE
Ga0208974_10035118F032635AGGAMERQWRLADKNNHYYHQSYNGLVVGHAYNVVHTIIWGAKIPINAAEELILGHYVELEYAKRAIEEYWEEKDRTFEVVHEHLLSGPTS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.