NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255079_1004036

Scaffold Ga0255079_1004036


Overview

Basic Information
Taxon OID3300027601 Open in IMG/M
Scaffold IDGa0255079_1004036 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3804
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007361Metagenome / Metatranscriptome352N
F008489Metagenome / Metatranscriptome332Y

Sequences

Protein IDFamilyRBSSequence
Ga0255079_10040362F007361GGAMSVLFSLEADCLGLHEQGATDPDWKRSIEKYRMRYKYVADCSTYGYLPKAVVHDSIKVYVKKDAEASAKECTERFGYEVHLPSVQMLRQYADDWASSNSVMTIDEGELFKLDTLRRVWVHCFQNERAFPEEKAARLETMNIQRHEPEKVFSIENGNRLVKEVF
Ga0255079_10040366F008489N/AKFPPAWAGIWTGLNVLQIVKTENAYGDRCFSIARGSDGSIQIWEITKSNKFDSNLSDPKKEIRWLVQTRAYNFELPFGLKRLDSGDIFIDSLEGNVSFNVEYRPDQYPGWLEWADWSECAIVDQCVTGLCPLTNFQPQYRPKMRLPTPADIPCNSTISTPTRNLYEVQMSLTITGYCRIKSIRVHAYDVQESAVGECRTFQGCKVLEACDINPLFYTSE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.