Basic Information | |
---|---|
Taxon OID | 3300027394 Open in IMG/M |
Scaffold ID | Ga0209904_1000300 Open in IMG/M |
Source Dataset Name | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4687 |
Total Scaffold Genes | 12 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden: Kiruna | |||||||
Coordinates | Lat. (o) | 68.3534 | Long. (o) | 19.0472 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F101011 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209904_100030010 | F101011 | AGAAG | VKFWRRGVAVELDDEYDDEPSIRNLIERLRKLGEPPRPLDHLYAVAVGGALSDRLNGLSDRQIGQLLFDFCWPELYLNGPELIICTHAIDRLRRSTGGAVTNEEAEDNLKQQPVCPKCGNELFLHYGIDEPDFWLCDRVACRHKRSVR |
⦗Top⦘ |