NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209904_1000257

Scaffold Ga0209904_1000257


Overview

Basic Information
Taxon OID3300027394 Open in IMG/M
Scaffold IDGa0209904_1000257 Open in IMG/M
Source Dataset NameThawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5118
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location
Location NameSweden: Kiruna
CoordinatesLat. (o)68.3534Long. (o)19.0472Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002781Metagenome / Metatranscriptome530Y
F005157Metagenome / Metatranscriptome410Y
F032071Metagenome / Metatranscriptome181Y

Sequences

Protein IDFamilyRBSSequence
Ga0209904_10002574F002781GAGMAIPCHVRRAARRQTRKELRRVSQLKRSNVRGYSALGMLPVNWHKALLLFLWITPHVLLGVLAAILWKRRLYREFPFFLAFVLYEIAEFMLLFALYYILGVNLEQNGYAYAFSVTQMISIALCFGVIDEVSKDLFRESQFLKVAARRSLMCVTGLLLVMGVLLAVYAPGDNSAKWYAGVFVVNRGAAMVQSGLLLSLLLFSRFLGLSWRRPAFGIALGLGVLTSVDLATYALRAEFTSTVGGEFLNLLITGAYLVCVSIWIGYLRAPELEPAASLAIVPHDEVETWNTELQHLLRD
Ga0209904_10002575F005157N/AMRLKSAVEDFEANTLRAVPGLLGRLSYVGRLQEGKGTGNGRYEHWGLARVYGDDAAQRAIRASHRVLLSDVLKKPLAALLKDVLASCSNEDLTEAEFLASLTQAHSLPKPLSPAARAHLRSVLSALLALVESRDAANLQGASQSRQPAQEPRPPAGT
Ga0209904_10002579F032071AGGAGGMSETRVVLDKDASPERKRYRGLLEITDLVVRAKSLPDAFKELAPPVLALTAGELLNYSLHDPRRDCM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.