NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208432_1009891

Scaffold Ga0208432_1009891


Overview

Basic Information
Taxon OID3300027380 Open in IMG/M
Scaffold IDGa0208432_1009891 Open in IMG/M
Source Dataset NameDeep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1788
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)40.178Long. (o)-81.073Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009143Metagenome / Metatranscriptome322Y
F024319Metagenome / Metatranscriptome206Y
F096663Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0208432_10098911F096663GGGGGMSKSQLEKDLEIKESFIDLLNDLYPTVKIGYSTFTPAEILE
Ga0208432_10098913F009143GAGGMSKWDTIQADVADAYVYLEEEEAYNKALAEGLDLRLSEYEEEEMSALTLDWDN
Ga0208432_10098916F024319AGGMTNRIWESRNDYQNDAQRLGYVTCSAGCGRVTAWSLCVMCGGNYAEHNLLGKAVI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.