| Basic Information | |
|---|---|
| Taxon OID | 3300027376 Open in IMG/M |
| Scaffold ID | Ga0209004_1024516 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 970 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Davy Crockett National Forest, Groveton, Texas, USA | |||||||
| Coordinates | Lat. (o) | 31.11 | Long. (o) | -95.15 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022942 | Metagenome / Metatranscriptome | 212 | Y |
| F024632 | Metagenome / Metatranscriptome | 205 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209004_10245162 | F024632 | GGA | METRSKLREARLRRKYPEVHGKVVDFITHTIDDGMLYFTVRFTDTTSFCVRYACEMFAAGAELSDWQSGDFHIIREYMKPIPR |
| Ga0209004_10245163 | F022942 | N/A | GSPFLKQPSECSPKLRIYQSLFLLNEGIDHVVALLRDLGKFPFADKESVQCAVVEIEEVRCDMNADFTEKLADSERFDEGHFWKLRRAFEKKWRDPDDVYIDVERREEERKKLGLPSRVVGSILPHSAVAQAEERWEAEQERKKKRPRKHRK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |