NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209300_1012302

Scaffold Ga0209300_1012302


Overview

Basic Information
Taxon OID3300027365 Open in IMG/M
Scaffold IDGa0209300_1012302 Open in IMG/M
Source Dataset NameSubsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2231
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameOhio, USA
CoordinatesLat. (o)39.849Long. (o)-81.036Alt. (m)Depth (m)2500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001460Metagenome / Metatranscriptome690Y
F013184Metagenome / Metatranscriptome273Y
F020171Metagenome / Metatranscriptome225Y
F092053Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0209300_10123021F092053AGGMKLSSEVKEDLQDQADQIIYFEAAMSNEDKASKAVYERLVEIYKVAFKEGAKSK
Ga0209300_10123023F001460GGAMLGYTESDLNRMINAVHDAKLFYLRYPSDLMDKTELRTDLEMAVSFMQGLWAEGYFD
Ga0209300_10123024F013184GGAGMKNYAFVIKLAGSVMANNEKEAHNKINAHLDELGEVDSSRYDLGWPEVSWDMEYDLC
Ga0209300_10123025F020171AGGAGGMSEQFIDTIAEHITGAIQQEISEHLFDQWSAKNLDEGPDYAEHMFMQFASDGLKQQYNEYYGYIEGDEYLL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.