Basic Information | |
---|---|
Taxon OID | 3300027283 Open in IMG/M |
Scaffold ID | Ga0209643_1044070 Open in IMG/M |
Source Dataset Name | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/37_all (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 793 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Surbsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mt. Terri, Switzerland | |||||||
Coordinates | Lat. (o) | 47.379 | Long. (o) | 7.1648 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028303 | Metagenome | 192 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209643_10440701 | F028303 | N/A | MMTKIEVEISGELSRQIERIVRDGWFPSEEALAQEALQQFVEAKSFLGDSPRMLKRFAADALNESKPDTALKF |
⦗Top⦘ |