NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208926_1017052

Scaffold Ga0208926_1017052


Overview

Basic Information
Taxon OID3300027205 Open in IMG/M
Scaffold IDGa0208926_1017052 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1091
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2327Long. (o)-123.9168Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001259Metagenome / Metatranscriptome735Y
F016253Metagenome / Metatranscriptome248Y
F064717Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0208926_10170521F064717N/AMSLLQKLGLTKESMAKMLGTVPAFKDPDPMVYRRWETVPANIRESILKEHPTRTYRELAKKYGISPSCVWNIKNKQPNKQ
Ga0208926_10170522F001259AGGAGGMKDSFAFIYVHAWNGMVRVESLDTARFIDGNPEWKHVSTVNALYILESILRAKGKERNLIIKHLLT
Ga0208926_10170524F016253GGAGGMSDKIKSFIDCGTGVYSITKKEAGEIHKAAKKVKNYAFSYWTRNRKAKEAK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.