NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208800_1004906

Scaffold Ga0208800_1004906


Overview

Basic Information
Taxon OID3300027193 Open in IMG/M
Scaffold IDGa0208800_1004906 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1663
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Escherichia phage vB_EcoM_APEC(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2Long. (o)-123.94Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048174Metagenome / Metatranscriptome148Y
F075867Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0208800_10049063F075867GAGGMNAALKPSTKHFLQYDAATFENEGFKTLNGRISQLALEPRFWSVSVKVITENFAGTEKIKDHFNFKTSERCKLSDLREQVKKEVLDKDDYLPVCTQCLVTARVMM
Ga0208800_10049065F048174GAGMSDKGQLNNKDVQSHSNAVTGAVLGEMERLREDLDRLHRERDSFQRQCAVMAEENAIWEAESKRLDWMVKNRGRIEWEFGGNCYVTFMHKNEFKATLGSDDTRIEIDRAMEMCK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.