NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255064_1005681

Scaffold Ga0255064_1005681


Overview

Basic Information
Taxon OID3300027138 Open in IMG/M
Scaffold IDGa0255064_1005681 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2350
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003543Metagenome / Metatranscriptome480Y
F003689Metagenome / Metatranscriptome473Y
F060898Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0255064_10056811F003543AGGAGMANENIVTNIVANADFSGLIADVNKVTASLSKLQAQLIASDAKLANQVAVMNRSFSENLRRTGQFSTHFVTLTSDTEKFGKSLDGGKLKLRDYFRTFQEHTKTSGGIVRDLAKQQVALQNAIIQPLGKNAQGLMQFNVQVPQGLDNIKNKTAIARQELQILNK
Ga0255064_10056812F060898AGAAGMPELIQTLKSFKKQKAEDRKFAAGLKGIEINIDEDEEEVQEGKTFEDIQRKALGINASGDDILSLQGPLAASAGFGIGAGLGYSKE
Ga0255064_10056815F003689N/AEQILFTIYSTDVSEINQIRNLMMDLYRRMDESARDANLYSGISQKFKFYSIFVADISPTAPSEELAGFLSTDVVLEVKYARHVDSNGRFL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.