NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255066_1000110

Scaffold Ga0255066_1000110


Overview

Basic Information
Taxon OID3300027131 Open in IMG/M
Scaffold IDGa0255066_1000110 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14646
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (69.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000545Metagenome / Metatranscriptome1038Y
F000645Metagenome / Metatranscriptome962Y
F009683Metagenome / Metatranscriptome314Y

Sequences

Protein IDFamilyRBSSequence
Ga0255066_100011021F009683AGGMKVIREAGQVSDTQKSLNEWLEEAGNTLFDRGIEYGDPRHNLLRIFKISKALGIQLRDPADLAIIAIATKLSRMVESPEREDSYLDLIGYAAILGRLRFSSPEDWDDIESDSQSQ
Ga0255066_100011022F000645GAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHILAESLVNSCDVYIIKTELYRTEADIHPWTTGLSSESKSKQYALELAETGSLGRALNLAGYFAKINQSPKKAIETTKPALAEFIKEQRPNDPDPIVWDVTAVADALGAEIIDELPLCSNGCGPMILKQGTKEGKEYRGWVCPVPKSGHPAKWMRIGSDGHWVFQK
Ga0255066_100011023F000545N/AMKQDAHPFKCSTCLAVTPHIELYRYETSDIPEAPEEVWLIECQRCFLQRIIYPSDRVASKEDDITRCDKCGNWKMKSGKCRVCRLAAGFEKISVKYWTGNATMERPYNDEQTPLY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.