| Basic Information | |
|---|---|
| Taxon OID | 3300027129 Open in IMG/M |
| Scaffold ID | Ga0255067_1001064 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4931 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (77.78%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oregon | |||||||
| Coordinates | Lat. (o) | 46.1812 | Long. (o) | -123.1834 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000369 | Metagenome / Metatranscriptome | 1222 | Y |
| F024550 | Metagenome / Metatranscriptome | 205 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255067_10010641 | F024550 | GGA | MSIYQEKAKECKCCGKHVPLPTVLKEYNGIQVCPTTFANIVEYKRIWKSLGTR |
| Ga0255067_10010643 | F000369 | AGAAG | MDMELADHFDRMNKVVEELLKGNNPTQIATLTGFKRAEVVELIGEWKTVVHNDTAARERAKEAIVGADQHYAMLIKEAWKTVEDADQAGQLSVKSGALKLIADIEGKRIGMLQEVGLLETERKQDILVKILKEVTASCPKCKMEVAKRLSQITGIVEPVEIIEEVSGS |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |