NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255090_1024901

Scaffold Ga0255090_1024901


Overview

Basic Information
Taxon OID3300027123 Open in IMG/M
Scaffold IDGa0255090_1024901 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1011
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000962Metagenome / Metatranscriptome820Y
F030360Metagenome / Metatranscriptome185N
F045700Metagenome / Metatranscriptome152Y

Sequences

Protein IDFamilyRBSSequence
Ga0255090_10249012F045700GGAMNIRPSQCFECETGTYKDVTVNYFSQLSGGRSCVTKDVTIQRCDICGAEILDSKASKIIESNIERNFPGYYERTRSRRN
Ga0255090_10249013F000962AGGMNAHVPEEIKSKYPYMEFRGKQRQMNDRTVIEAYNHAINQNFFYSFDEDFFWFPGQIPDYKLPKVS
Ga0255090_10249014F030360N/AMTEQTYMNLKDAVKRPVLSEKTVNRSNKAFVRMVDSYQKWNESISADEPRETYEDDIFNCLFEYDLDGYNLAEYLKSKIYLEPDAGLVDILDDMIYVKKSLEDEMLKQWVKENFLTISDDVVGKKVNAKQGSRKYENHYITGIRADTYQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.