Basic Information | |
---|---|
Taxon OID | 3300026672 Open in IMG/M |
Scaffold ID | Ga0208214_103850 Open in IMG/M |
Source Dataset Name | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1102 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 595 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Nunn, Colorado, USA | |||||||
Coordinates | Lat. (o) | 40.81667 | Long. (o) | -104.76667 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058773 | Metagenome / Metatranscriptome | 134 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208214_1038502 | F058773 | GGAGG | VSLVRPKDEGEHWVQLVLLTMAIWVAMFVTMAVIPSFWLYFADGTLKWTGKFTVPYGLGELVLPMQAVRDVIVVLWYGVALTGFGLAVRAYNKR |
⦗Top⦘ |