NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255270_1035706

Scaffold Ga0255270_1035706


Overview

Basic Information
Taxon OID3300026572 Open in IMG/M
Scaffold IDGa0255270_1035706 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1263
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079705Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0255270_10357061F079705N/AFIEKNMSTNQFTQTAKANYPDALNTMNILMAAPGDGNVYTFGSHYLETSNVPTSHYYGNLAYKWNGTTNTWSPIAKMNGFPSVSADETFIFSYQGKVYISGARYTAVDKGSRVLFDYWFGYYDPATNSYTTIKNFKTVGLSEGPSFTTLGNMNGRTYHEDADYLYDKFNNKYSKAAYIATGFLPAAVEKPQYWAPTPVLNVAKTPGSATQYAHYTENSNYYLVAQTQSQITVPSYAVKV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.