NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209648_10004895

Scaffold Ga0209648_10004895


Overview

Basic Information
Taxon OID3300026551 Open in IMG/M
Scaffold IDGa0209648_10004895 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11395
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000529Metagenome / Metatranscriptome1047Y
F001792Metagenome / Metatranscriptome633Y
F008332Metagenome / Metatranscriptome335Y

Sequences

Protein IDFamilyRBSSequence
Ga0209648_100048951F008332AGGCGGMTTMLADPPRKTTMGVGFEANRGRAGDPQAWKKAIGTKPVEARLALLPDSSSRWDRISLSAFGQLAILGFLLMI
Ga0209648_1000489510F000529GAGGMFSAMLLAISIVALAQFALYYWRAVLAGVAAQPVSDRVLVAAQVENGRLTPQHFPTLAGLHDLTPELYPYRSGLGQVRLYYRMIESLDALLGKMFPTFSVWSERERILCARYAAVQVDRRLQANLDLVAALRSC
Ga0209648_1000489511F001792N/AMPQGKLFRFLLLAALGLCAGFLALAIAVPIEPQVAAPLIALFSPGLKLAEFVTPETGKSLAWTFGWFLRIAIAANAAFYYALFAFVAYLAGRRSK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.