NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209474_10220445

Scaffold Ga0209474_10220445


Overview

Basic Information
Taxon OID3300026550 Open in IMG/M
Scaffold IDGa0209474_10220445 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1195
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F001079Metagenome / Metatranscriptome785Y
F031478Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0209474_102204451F000280AGAAGGMAERDPEGRQVPARPLAGYRDVGEDVRHARGSMIRAWVILAVLVLFYLGWTLIVFFLE
Ga0209474_102204452F001079AGAAGMSATEPPLASALPYVSWSSLTVAVVPADTWPQVFASMQALKGHVQEYPGCQKLEAFVQAEAEGAVRIHCFTTWDTPGQLEAFLERGYTFERMLIDVAEVIAQPTIVMEKVF
Ga0209474_102204453F031478AGGAGMAMPDADAGSPAKVTHYYDYLQAHSQTFQKPDTWHVHWLDLAWLWGFVIVLALVILWWLWQYRTTRQRGVYPVDQFGGYTSVGHLVWGQKF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.