Basic Information | |
---|---|
Taxon OID | 3300026388 Open in IMG/M |
Scaffold ID | Ga0232083_102414 Open in IMG/M |
Source Dataset Name | Metatranscriptome of enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.SFe4 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3204 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New York | |||||||
Coordinates | Lat. (o) | 42.4447 | Long. (o) | -76.485 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031111 | Metagenome / Metatranscriptome | 183 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0232083_1024141 | F031111 | N/A | RRKKEKSRFLIGKKRCISNIPQNSYYQTIVNIPAAYNFCCYYPQNLPSSQIGKQVKKILKPLNLALIKLSKPKLTFP |
⦗Top⦘ |