NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209377_1226974

Scaffold Ga0209377_1226974


Overview

Basic Information
Taxon OID3300026334 Open in IMG/M
Scaffold IDGa0209377_1226974 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)615
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004291Metagenome / Metatranscriptome445Y
F007884Metagenome / Metatranscriptome343Y
F009247Metagenome / Metatranscriptome321Y

Sequences

Protein IDFamilyRBSSequence
Ga0209377_12269741F009247GAGVKQHLGRQSGVQNVEVSLRDGNVDVTPKEDGQIDPAQLLKATYDSGVTAAELDM
Ga0209377_12269742F004291AGGAGGMNTKKIALLVLFGSMVVVPAAQAQIKHIEMRVEGMT
Ga0209377_12269743F007884N/ADLESRFWLSYRPYESKNVAREWFIGPVLTWLRSQNDRIAGASKRGSGGDVLLAGMTTYFGVRAGMHVWLGMDWAVAHSTSPLFMPVRRHISFGITQQFRLHR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.