Basic Information | |
---|---|
Taxon OID | 3300026295 Open in IMG/M |
Scaffold ID | Ga0209234_1093997 Open in IMG/M |
Source Dataset Name | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1134 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Angelo Coastal Reserve, California, USA | |||||||
Coordinates | Lat. (o) | 39.718176 | Long. (o) | -123.652732 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F100821 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209234_10939972 | F100821 | AGGGGG | MLTLTLNTPREVHLLRSLLQRRIEQLDKEADGSSAGAALLHRRQAQELREMLSRVQVEAARPVEPN |
⦗Top⦘ |