NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209438_1014072

Scaffold Ga0209438_1014072


Overview

Basic Information
Taxon OID3300026285 Open in IMG/M
Scaffold IDGa0209438_1014072 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2680
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010456Metagenome / Metatranscriptome303Y
F030712Metagenome / Metatranscriptome184Y

Sequences

Protein IDFamilyRBSSequence
Ga0209438_10140722F010456GGAGGMRKLTSTLVAAVALVALPHMALAQRARSAASGPKNEIGIDLGAAYSHLGSGCAADCGGVGIGTPIDIRWGFMARGQLSFEPRFSLNYISGFGGHDLSFNPDLNVIYRMKKSTARKGMYLTGGLGLAIDNSASGGPSTTATQLSLNAGVGKRIPMESNAWRIEGFLRYNLENSGKGIPSRFDIGARLGMSFWR
Ga0209438_10140723F030712GGAGGMKRFGLVLLVAALCIVAARPVMAQRAMAPAGSLRYGVSAGVLMPIGDYGTADKLGFVGGAGATYWLAGQPIGIRADLSFSSTSHDGVGATGSTKILGGMASVVFALNPASAPARIMLTGGVGIYNLNFGSGFAKQTKLGFGGGAAVAFKMGTGSTRLVVGTRYTSVSTDGTSRLNFLPITVGLSFGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.