NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209612_1020779

Scaffold Ga0209612_1020779


Overview

Basic Information
Taxon OID3300026250 Open in IMG/M
Scaffold IDGa0209612_1020779 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2615
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameWashington, USA
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003987Metagenome / Metatranscriptome458Y
F004383Metagenome / Metatranscriptome440Y

Sequences

Protein IDFamilyRBSSequence
Ga0209612_10207793F004383GGGGGMACDGESPCRECKGSGSECSMDPAECGHAVLPSSDNLLERAFMARIRADEYREVLAALQQEFDERPDVIDLKRQIERCEEERRQCIAQAKAAGISKQGSFLLKIRTRKQRTVIPKLFFVKHGAEAFVECATIAIGKAEALLGKAALDDCCEVAVKDLGATVEYVRPGVSE
Ga0209612_10207794F003987GGGGGVIPALPCGTYSDGDIPTGAFYVAAFEDGDVPHHVTECRIETLVQALRALQACGYDDVEVGDIEQGGKQHLLLIGLDGEARFGDRQIGCIAVLPVGVD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.