Basic Information | |
---|---|
Taxon OID | 3300026250 Open in IMG/M |
Scaffold ID | Ga0209612_1020779 Open in IMG/M |
Source Dataset Name | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2615 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Washington, USA | |||||||
Coordinates | Lat. (o) | 47.6525 | Long. (o) | -122.3049 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003987 | Metagenome / Metatranscriptome | 458 | Y |
F004383 | Metagenome / Metatranscriptome | 440 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209612_10207793 | F004383 | GGGGG | MACDGESPCRECKGSGSECSMDPAECGHAVLPSSDNLLERAFMARIRADEYREVLAALQQEFDERPDVIDLKRQIERCEEERRQCIAQAKAAGISKQGSFLLKIRTRKQRTVIPKLFFVKHGAEAFVECATIAIGKAEALLGKAALDDCCEVAVKDLGATVEYVRPGVSE |
Ga0209612_10207794 | F003987 | GGGGG | VIPALPCGTYSDGDIPTGAFYVAAFEDGDVPHHVTECRIETLVQALRALQACGYDDVEVGDIEQGGKQHLLLIGLDGEARFGDRQIGCIAVLPVGVD |
⦗Top⦘ |