NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209862_1056700

Scaffold Ga0209862_1056700


Overview

Basic Information
Taxon OID3300026222 Open in IMG/M
Scaffold IDGa0209862_1056700 Open in IMG/M
Source Dataset NamePermafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)693
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location NameArctic
CoordinatesLat. (o)68.6137Long. (o)-149.3144Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049712Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0209862_10567001F049712AGAAGGMKAAVRQQLDPSIRSTDTRDFETTLRSKIVGQVEGVQSLVMKLDRYKLR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.