NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207966_1057897

Scaffold Ga0207966_1057897


Overview

Basic Information
Taxon OID3300026119 Open in IMG/M
Scaffold IDGa0207966_1057897 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)990
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002030Metagenome601Y
F081449Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0207966_10578972F002030AGGCGGMIGFLIFGLVILSTICLWILIEERKSWKFLVWFIPILLVIVTSTYLTYTSILGFPKVGIPEKGLYLRHYIDEPNWIYLWVLSKKNVPMSYQLVYSREKHNALEGVKGQAAEGAFMVLGEDESLGPGDGEGDQKGGRSGEGYTIGGDISFYKWDFTDNMPPKNTQE
Ga0207966_10578973F081449N/ASKTRKPIKKQLTVKIELHKVDPYKIWWIGEKTFTHKGQEETFVRFTIDQEGKQVGGFTYEKKKFVTPFGNMGVVNPNNDEPTGASSFESGTEESRYHPGDRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.